NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0076924_1381298

Scaffold Ga0076924_1381298


Overview

Basic Information
Taxon OID3300005747 Open in IMG/M
Scaffold IDGa0076924_1381298 Open in IMG/M
Source Dataset NameSeawater microbial communities from Vineyard Sound, MA, USA - control T14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)598
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.4417Long. (o)-70.7744Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018943Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0076924_13812981F018943N/AIAITGHTSPMGKDVYEHYSKTHQCLGISRTTGYDFTNTDSLNNTVSEVLARDVFLNIAHVGASQSSLLLKLQERWTHDAPLRKVITIGSLATKVPKKLLDQVGIDKQYLKDKHHIDAVHNALANQTPFGPQLKFSLVRVLNYGEKTGDRSGEPTCTAQDIIRTIDYVIDESMYISTLDVRRS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.