| Basic Information | |
|---|---|
| Taxon OID | 3300005747 Open in IMG/M |
| Scaffold ID | Ga0076924_1374755 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 571 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA | |||||||
| Coordinates | Lat. (o) | 41.4417 | Long. (o) | -70.7744 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030897 | Metagenome / Metatranscriptome | 184 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0076924_13747552 | F030897 | N/A | MQVEAGVLHLEHKGIEVEASVIWDLEQGGPLYAMKDGKIFMSLSPEELKALYVLYRDIELKGTVEDA* |
| ⦗Top⦘ |