Basic Information | |
---|---|
Taxon OID | 3300005747 Open in IMG/M |
Scaffold ID | Ga0076924_1100582 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6666 |
Total Scaffold Genes | 16 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | 41.4417 | Long. (o) | -70.7744 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030437 | Metagenome / Metatranscriptome | 185 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0076924_110058215 | F030437 | N/A | MNHSQEENWVTGKLGTTTSTAYRTSIWTPVDEDHLHKYRQKYIDEGWKSYCWTKGSSGYDKYFLSKLPKDDFEHLLMVEKKYGYFTLFYDINE* |
⦗Top⦘ |