Scaffold Ga0076948_1052754

Overview

Basic Information

• Taxon OID: 3300005739
• Scaffold ID: Ga0076948_1052754
• Source Dataset Name: Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2576
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.411221
  • Long. (^o): 103.905587

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064426	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0076948_10527541	F064426	GAGG	MPLFNSDDYANLHPEHDQVPSGMTDQSFMVDFFVMYTDWFADVVKRWPDSADEISIAFGEASPLWSRVSPKCESDDAQLMLLLTTATSAMKLLDSIHSDTAEDVVAHLSEIARIRRGECKSASERGEVDAVFTAMYRFMRSTSGDARIEFLMQVMDLGHDVHSQVDAEKAVRVSASLMVASLSIVVAVPDLETRETFIEVLRAHTEAIAAEPVVPYYENDGE*