Scaffold Ga0076948_1045889

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0076948_1045889

Scaffold Ga0076948_1045889

Overview

Basic Information
Taxon OID	3300005739 Open in IMG/M
Scaffold ID	Ga0076948_1045889 Open in IMG/M
Source Dataset Name	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1170
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.411221	Long. (^o)	103.905587	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057923	Metagenome / Metatranscriptome	135	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0076948_10458893	F057923	GGA	MTQEEFDNHPAWKDANFEGAERTMLQNGMRMTLVEKLRWLEEAETFSLQFPINRRRAIAEGRLPPED*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.