Scaffold Ga0076927_133029

Overview

Basic Information

• Taxon OID: 3300005737
• Scaffold ID: Ga0076927_133029
• Source Dataset Name: Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T14
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2411
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.4417
  • Long. (^o): -70.7744

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029711	Metagenome / Metatranscriptome	187	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0076927_1330293	F029711	GGA	MGLEAKGTFPFQMYQIPEFTATTVATQPTPPAKVSADKPKVVEPATRSEVTIRLDKYWQEKAEELLNRQRSMAELAYSPNGRIVAPIDVGKILDVEV*