NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0076927_123383

Scaffold Ga0076927_123383


Overview

Basic Information
Taxon OID3300005737 Open in IMG/M
Scaffold IDGa0076927_123383 Open in IMG/M
Source Dataset NameSeawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1247
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.4417Long. (o)-70.7744Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056526Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0076927_1233831F056526GAGMASIYNDIRAALENKLANTANLPSGIAYENVSFSPTTGTSYLQTNFLP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.