Scaffold Ga0076923_103742

Overview

Basic Information

• Taxon OID: 3300005735
• Scaffold ID: Ga0076923_103742
• Source Dataset Name: Seawater microbial communities from Vineyard Sound, MA, USA - control T0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1180
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.4417
  • Long. (^o): -70.7744

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033444	Metagenome / Metatranscriptome	177	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0076923_1037421	F033444	AGGAG	MDIKKIFTWLPIALALIGSLYTGINVISKLNNTIEQHTIAISNLEQSLVSIDERYKIEIKNLTQKYSEGREELFREVTFLNTEIAQARAKVEALDNSYYKVNDAVRDLGYDLKDFKREVTGDY*