| Basic Information | |
|---|---|
| Taxon OID | 3300005723 Open in IMG/M |
| Scaffold ID | Ga0076816_10382367 Open in IMG/M |
| Source Dataset Name | Mastotermes darwiniensis gut microbial communities from Townsville, Australia - TV02 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1607 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Termopsidae → Termopsinae → Termopsini → Zootermopsis → Zootermopsis nevadensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Gut → Termite Gut Microbial Communities From Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Townsville, Australia | |||||||
| Coordinates | Lat. (o) | -19.280075 | Long. (o) | 146.824457 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077443 | Metagenome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0076816_103823671 | F077443 | N/A | CCEDGRWMELAQDRVQWQALVLAVLNLRVLLPES* |
| ⦗Top⦘ |