Scaffold Ga0076816_10170095

Overview

Basic Information

• Taxon OID: 3300005723
• Scaffold ID: Ga0076816_10170095
• Source Dataset Name: Mastotermes darwiniensis gut microbial communities from Townsville, Australia - TV02
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Queensland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2139
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Eresoidea → Eresidae → Stegodyphus → Stegodyphus mimosarum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location

• Location Name: Townsville, Australia
• Coordinates
  • Lat. (^o): -19.280075
  • Long. (^o): 146.824457

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064841	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0076816_101700951	F064841	AGGCGG	LGVLGPLLNRSGLSIRNGVLLYKHLTRLVMDNTCPVRRSAAHSHVRKLKVLQSKCFI