NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066905_100227380

Scaffold Ga0066905_100227380


Overview

Basic Information
Taxon OID3300005713 Open in IMG/M
Scaffold IDGa0066905_100227380 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1416
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004510Metagenome / Metatranscriptome435Y
F012740Metagenome / Metatranscriptome277Y
F040988Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
Ga0066905_1002273801F012740N/AVADQMTHEESRTIMRRIALDYDRLAKLAEEQLADQERGATGDKT*
Ga0066905_1002273802F004510GGAGMITWALIASAVIALVLVVLMQGKWTSRDSWFAAVFASALMAMVIDHFVNYINQ*
Ga0066905_1002273803F040988GGAGMPITPYLKGPYYFDLETRRALGIALELACIALSAGDDDDHVRRTIADKLIALARTGERNPDVLCDKALEAICRPEHNLEKPSTHTVGRSPVSLASSAPAARPEPPGQR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.