| Basic Information | |
|---|---|
| Taxon OID | 3300005683 Open in IMG/M |
| Scaffold ID | Ga0074432_100802 Open in IMG/M |
| Source Dataset Name | Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91802 Phage Sequencing |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3082 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. LAMO17WK12:I10 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | St. Lucia, Queensland Australia | |||||||
| Coordinates | Lat. (o) | -27.49999 | Long. (o) | 153.012098 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025940 | Metagenome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074432_1008024 | F025940 | AGG | MATQKLNLTRDQLATFLKNHEQIKQFEKLFQVVDTLEPIXXXXXXXXXXXAQASANEALAQIAALALSTSVTDAVFEAKLQFALDAIPRLADALELLALAPIRNNVELAYDVSGILPLANLPASVRSNQVLTWLSM* |
| ⦗Top⦘ |