| Basic Information | |
|---|---|
| Taxon OID | 3300005664 Open in IMG/M |
| Scaffold ID | Ga0073685_1181737 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 525 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic → Freshwater Viral Communities From Emiquon Reservoir, Havana, Illinois, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Havana, Illinois, USA | |||||||
| Coordinates | Lat. (o) | 40.362238 | Long. (o) | -90.047137 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032247 | Metagenome / Metatranscriptome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073685_11817371 | F032247 | N/A | DDAIFNLETYGRHMGNRYIAINHDRHDALLLQNAVIVLEDAGMLERDPHPKWSQCNVRIINKPVPKIDYTKGL* |
| ⦗Top⦘ |