NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073903_10486463

Scaffold Ga0073903_10486463


Overview

Basic Information
Taxon OID3300005657 Open in IMG/M
Scaffold IDGa0073903_10486463 Open in IMG/M
Source Dataset NameActive sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)538
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location
Location NameAustria: Klosterneuburg
CoordinatesLat. (o)48.3Long. (o)16.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098921Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0073903_104864632F098921AGAAGMSTPDPALTAALTDMLTDACWRCSDGDGATCDPCLSELVAKAERDAEARTVMASLRGMFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.