Scaffold Ga0073903_10056760

Overview

Basic Information

• Taxon OID: 3300005657
• Scaffold ID: Ga0073903_10056760
• Source Dataset Name: Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1863
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location

• Location Name: Austria: Klosterneuburg
• Coordinates
  • Lat. (^o): 48.3
  • Long. (^o): 16.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051906	Metagenome / Metatranscriptome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073903_100567602	F051906	GGAGG	VTPHAAFIRRAGARHYRCTTCLERVAPSQRVPHLNRATARAAEYGTTIPTHDLGDDE*