| Basic Information | |
|---|---|
| Taxon OID | 3300005655 Open in IMG/M |
| Scaffold ID | Ga0073905_10041711 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2171 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Austria: Klosterneuburg | |||||||
| Coordinates | Lat. (o) | 48.3 | Long. (o) | 16.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004727 | Metagenome / Metatranscriptome | 426 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073905_100417113 | F004727 | AGGA | MKVQLTYHDNESLTVEEVVATAVHNYGKSVNVEVMPESTIAYDLIYFGLQRLMTHQQLSMLYDRGSDYQSEVRKLRQETIYNVTELIDQVIIDNEARVG* |
| ⦗Top⦘ |