| Basic Information | |
|---|---|
| Taxon OID | 3300005651 Open in IMG/M |
| Scaffold ID | Ga0079202_10052489 Open in IMG/M |
| Source Dataset Name | Marine algae microbial communities from Blueberry Hill - Blueberry Hill, Maine |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1558 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Blueberry Hill, Maine | |||||||
| Coordinates | Lat. (o) | 44.342 | Long. (o) | -68.065 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006930 | Metagenome | 361 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079202_100524893 | F006930 | GGA | VTVMVPHMVHLQDVVKLHTFALGHLGAILLACFGFDLRFALVAFDLVSDSIWCEGVGVGVGARGGSTWA |
| ⦗Top⦘ |