| Basic Information | |
|---|---|
| Taxon OID | 3300005650 Open in IMG/M |
| Scaffold ID | Ga0075038_11385529 Open in IMG/M |
| Source Dataset Name | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 629 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 68.6137 | Long. (o) | -149.3144 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001412 | Metagenome / Metatranscriptome | 701 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075038_113855291 | F001412 | AGGAG | MNLKNVAKTVVLGLAVLLASSAFASNKGSLEVREPFEVNGQQLAAGEYQLRWDGTGSNVEVSFMQGKKEIAKTSAKVVELDKSSSYDSAVVDHSNGKVTVSQVRFAGKKYA |
| ⦗Top⦘ |