Basic Information | |
---|---|
Taxon OID | 3300005645 Open in IMG/M |
Scaffold ID | Ga0077109_1173101 Open in IMG/M |
Source Dataset Name | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 534 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water → Brackish Water Microbial Communities From Lake Sakinaw,Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sakinaw Lake (SAK), BC, Canada | |||||||
Coordinates | Lat. (o) | 49.682207 | Long. (o) | -124.005217 | Alt. (m) | Depth (m) | 120 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100723 | Metagenome / Metatranscriptome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0077109_11731012 | F100723 | N/A | QKYFKRKSTLIVPCGTISKMTNKKWTPRSIRWTEAERQAKKIQSQNVRQIRWLFWRESQALREKIHKEISEKLIAKREAIE* |
⦗Top⦘ |