Scaffold Ga0077109_1148597

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0077109_1148597

Scaffold Ga0077109_1148597

Overview

Basic Information
Taxon OID	3300005645 Open in IMG/M
Scaffold ID	Ga0077109_1148597 Open in IMG/M
Source Dataset Name	Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	592
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water → Brackish Water Microbial Communities From Lake Sakinaw,Canada

Source Dataset Sampling Location
Location Name	Sakinaw Lake (SAK), BC, Canada
Coordinates	Lat. (^o)	49.682207	Long. (^o)	-124.005217	Alt. (m)		Depth (m)	120
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033039	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0077109_11485972	F033039	N/A	KIMSPHQKAAHEIIHEYYFMLPNNGSLNHGPLSCDKRYKEAVQCALVGIKRLILTLEFMSIESNDPAIMDRINFYDEVQSEVYKIKDGDSKLSWDDLIEVFKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.