NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0077109_1047864

Scaffold Ga0077109_1047864


Overview

Basic Information
Taxon OID3300005645 Open in IMG/M
Scaffold IDGa0077109_1047864 Open in IMG/M
Source Dataset NameBrackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1434
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water → Brackish Water Microbial Communities From Lake Sakinaw,Canada

Source Dataset Sampling Location
Location NameSakinaw Lake (SAK), BC, Canada
CoordinatesLat. (o)49.682207Long. (o)-124.005217Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012446Metagenome / Metatranscriptome280N
F015582Metagenome / Metatranscriptome253Y
F019614Metagenome / Metatranscriptome228N

Sequences

Protein IDFamilyRBSSequence
Ga0077109_10478641F015582N/AMNTNIDPELQAEQLQDAKYLEELNHYVNTLATPSAEAVALYSAKLSNLEDIHTEIRSKYPDFMPIYDTSTDSECNHDLGKYQEQTYSISQRDMRRE*
Ga0077109_10478642F012446N/AMKKLQKEFTGNYDKVGMNKFVQIRKENNVAIYQRFNTDGTPRSYEVFIVKIVPKGAPLPNGKFVEESYEQYPGANAFGKTAFDCREIGQAEERFDQLVIKAKDSADAKEEAAKTGVRNRGRRASGNKIKLDMTLNKGTKFTAKFLMSVLGVTQPVLFPIIKQWEKEGSIKVNGSVKGEGKGRPATEYIVV*
Ga0077109_10478643F019614N/AMLEVSTWWVYSIYTMNVASIASNKIQVEYSAMPGDNREFLTFKVPNGWDDVKLLTNKVLTHNSKDFTFSGWNSDRNECYFVRLVNG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.