| Basic Information | |
|---|---|
| Taxon OID | 3300005645 Open in IMG/M |
| Scaffold ID | Ga0077109_1014958 Open in IMG/M |
| Source Dataset Name | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3383 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water → Brackish Water Microbial Communities From Lake Sakinaw,Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sakinaw Lake (SAK), BC, Canada | |||||||
| Coordinates | Lat. (o) | 49.682207 | Long. (o) | -124.005217 | Alt. (m) | Depth (m) | 120 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089822 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0077109_10149582 | F089822 | N/A | MRTRINKIIRVYDEERNNDEIIFDVYEVILEKLDNESLVKKS* |
| ⦗Top⦘ |