Basic Information | |
---|---|
Taxon OID | 3300005625 Open in IMG/M |
Scaffold ID | Ga0078785_11057 Open in IMG/M |
Source Dataset Name | Activated sludge viral communities from EBPR reactors in Madison, Wisconsin, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 919 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus subtilis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Madison, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.078418 | Long. (o) | -89.386482 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051551 | Metagenome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078785_110572 | F051551 | N/A | MSKSELLGAIPASNAFIANAIQSSKETLRRNNGDEGDSSKALLKFPCDNDPDNDPAMFSSYDKYSHAQIMDILSGDEWSSSTE* |
⦗Top⦘ |