NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068864_100050166

Scaffold Ga0068864_100050166


Overview

Basic Information
Taxon OID3300005618 Open in IMG/M
Scaffold IDGa0068864_100050166 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3591
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006487Metagenome / Metatranscriptome372Y
F021009Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0068864_1000501661F021009N/AAAGQVDARLLSALGALASLYHVDVAGFGAPAAGADPGVPLRRADISPVPAGRGRDAATLNSLKRFLLAQQAPFRPADVTPVRLASGQAVLHVEYTAPNPLGLLGAPN*
Ga0068864_1000501666F006487AGGGGGMRQRSHRRNLVVWSQSAGSVGKYGAPPFTRRRRIRRWIRTGALLTVVGLMPLARAVRARWRPLLAGAVLTMVGIVWLDGPGGLVLLPGLWLLLSAPLIPASPKADRVRRPEVELERAVFSHPAQRRLAIQAMAAHDKRFPVTGRY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.