Scaffold Ga0074649_1040542

Overview

Basic Information

• Taxon OID: 3300005613
• Scaffold ID: Ga0074649_1040542
• Source Dataset Name: Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2161
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Greece: Etoliko Lagoon
• Coordinates
  • Lat. (^o): 38.4825
  • Long. (^o): 21.315
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019411	Metagenome / Metatranscriptome	230	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074649_10405424	F019411	AGGAG	MIDEQKIKTIFDQEREAYRNRDKLTIEHVRSLEKQIENLLRDKASLQDQLNKYIDKEMEKR*