Basic Information | |
---|---|
Taxon OID | 3300005613 Open in IMG/M |
Scaffold ID | Ga0074649_1019177 Open in IMG/M |
Source Dataset Name | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4005 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (45.45%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Greece: Etoliko Lagoon | |||||||
Coordinates | Lat. (o) | 38.4825 | Long. (o) | 21.315 | Alt. (m) | Depth (m) | 25 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045690 | Metagenome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074649_10191774 | F045690 | AGGAGG | MLKIITDQVGKKGFVVQGTCITNPYYDETMRFEVDPIEYYGLTEDQLIQFEHMKPEPEEPQPSYEELVQKLKGMKFFIVRWSGDACEHKELFEDDDCVCHTSNRVDDPITFFNKYCYGDDVLKDLQGLSVGEKYQVDEMMQDIEIMRVE* |
⦗Top⦘ |