Basic Information | |
---|---|
Taxon OID | 3300005612 Open in IMG/M |
Scaffold ID | Ga0070723_10039084 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1834 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Coast | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020918 | Metagenome | 221 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0070723_100390841 | F020918 | AGGA | MKYSKDIGPNWHLRFRLIIQELKEELELTQVQLQIAERKLKKYEDNNTRTSRNGKDNNVVKLSRRISKRWD* |
⦗Top⦘ |