Scaffold Ga0066835_10000295

Overview

Basic Information

• Taxon OID: 3300005606
• Scaffold ID: Ga0066835_10000295
• Source Dataset Name: Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9923
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Eastern Tropical North Pacific
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054090	Metagenome / Metatranscriptome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066835_100002952	F054090	N/A	MDKNKLIATIILVFLGFSTSVILFLYQTERLDMETAQTLALYFFGAFIVFGAGYLYFDLKNLSNK*