Scaffold Ga0066852_10031526

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066852_10031526

Scaffold Ga0066852_10031526

Overview

Basic Information
Taxon OID	3300005604 Open in IMG/M
Scaffold ID	Ga0066852_10031526 Open in IMG/M
Source Dataset Name	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2028
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location Name	Pacific Ocean: Eastern Tropical North Pacific
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066702	Metagenome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066852_100315263	F066702	GAGG	MILKEIKYRNFKAKIVKLTRKQAKSGSMYGCYFPNTQTIAIQEKLPKITLLDTMLHEIGHFIADKSKIRLANLGEEGTVNFVASEFAKIFMQNPKLLTFIKRCTAR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.