| Basic Information | |
|---|---|
| Taxon OID | 3300005601 Open in IMG/M |
| Scaffold ID | Ga0070722_10347142 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 644 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Coast | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076930 | Metagenome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070722_103471421 | F076930 | GAGG | MIEKPIDEPTKRASHLGFRQGYEIANRTQIDESRRKDEFVNIVLETVINSLESTVFESISAELDRMNEKYPAFDSWKVFAAAVIQGAGENFLDRTGNEE* |
| ⦗Top⦘ |