NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070727_10188763

Scaffold Ga0070727_10188763


Overview

Basic Information
Taxon OID3300005590 Open in IMG/M
Scaffold IDGa0070727_10188763 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1158
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location
Location NameAtlantic Coast
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033812Metagenome / Metatranscriptome176N

Sequences

Protein IDFamilyRBSSequence
Ga0070727_101887631F033812N/AMEIGKQPTEQLLDFCFKTLNKALFEMSQNKAESDRKVLANILMNDLNEKFFRLTAADVTQAFHKGVREGEQLAINPRTWFNWLNKQKMKTNKLRIEQSQDGERLLIESNAQNIDKENVLKEFLELCVIEPFEEHCKGDEYTFQGINQAFQWLELNNFIVLTTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.