Scaffold Ga0070728_10549460

Overview

Basic Information

• Taxon OID: 3300005588
• Scaffold ID: Ga0070728_10549460
• Source Dataset Name: Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 601
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Candidatus Nitrosopumilus sp. SW (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location

• Location Name: Atlantic Coast
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013764	Metagenome	268	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070728_105494601	F013764	N/A	MMRTPSFFFFRTNSKNKQSSSLPPYSKRALVAVTVAIPMAFSLNLTLDSMASLMPLWGVIMINAIVIPSYMTFIIPKASKLLSSWLNSKASGVN*