Scaffold Ga0049085_10038369

Overview

Basic Information

• Taxon OID: 3300005583
• Scaffold ID: Ga0049085_10038369
• Source Dataset Name: Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1755
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location

• Location Name: Great Lakes, Michigan, USA
• Coordinates
  • Lat. (^o): 44.5046
  • Long. (^o): -83.045851

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029749	Metagenome / Metatranscriptome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0049085_100383692	F029749	N/A	MVNYRIFNAKEFIAAGAGTSGSLENAWGVMRGSAVCSGSVTLEGFVTPSGSTPASTRSTLKLEYLTQGQPIPCYIRSITVTSGTAYLLA*