| Basic Information | |
|---|---|
| Taxon OID | 3300005581 Open in IMG/M |
| Scaffold ID | Ga0049081_10255134 Open in IMG/M |
| Source Dataset Name | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 614 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Lakes, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 44.701094 | Long. (o) | -82.854085 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008490 | Metagenome / Metatranscriptome | 332 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0049081_102551343 | F008490 | N/A | MMNNSENSMMDDMGMEEDLMPYPTPDKQYPNAAKYSSYESIQTGAMGKMPS* |
| ⦗Top⦘ |