NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0049083_10000095

Scaffold Ga0049083_10000095


Overview

Basic Information
Taxon OID3300005580 Open in IMG/M
Scaffold IDGa0049083_10000095 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24303
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (62.22%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.504638Long. (o)-83.045851Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003750Metagenome / Metatranscriptome470Y
F004476Metagenome / Metatranscriptome436Y
F009266Metagenome / Metatranscriptome320Y

Sequences

Protein IDFamilyRBSSequence
Ga0049083_100000951F004476AGAAGMLFSKHGFKSVDTTEEFVKQAIEFGQKDIVLSMVHENGVIDIVISPTMDAIEADVYHFLNDDTELKYSMPIKTLTDNNISSLALTSAIHAYLSEAFKVAEMF
Ga0049083_100000952F003750GGAGMTEEIINRTMQVFLYTGGIIAFWQITKYMPKALYTTLECISVIASTVLCITPIAMIIEYILGGNIHTTMMFTGCLAGLGLLCGIWMVMVQSSRELQGKKQYKYVVL*
Ga0049083_1000009539F009266AGAAGMTDKERKILDKEIQYLCEQQDRVKAIREYTGINPGYTFLREVETIESLYKSVLDSRKYDKSTYFSAATSGWHVVYLRDKKTYKKDEEFRIKIFHTFVWSDNLE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.