| Basic Information | |
|---|---|
| Taxon OID | 3300005573 Open in IMG/M |
| Scaffold ID | Ga0078972_1213883 Open in IMG/M |
| Source Dataset Name | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 826 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.611006 | Long. (o) | -110.440182 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020112 | Metagenome | 226 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0078972_12138831 | F020112 | GAGG | MVSKAFKKCIELIEEMLREGYKLQITSLEVEKLIKISIGADKRTVQKYTRILTEDLAFLKTVTKNQFGIVIYKINIEAIEQFINEHLKEKLKQLR |
| ⦗Top⦘ |