| Basic Information | |
|---|---|
| Taxon OID | 3300005562 Open in IMG/M |
| Scaffold ID | Ga0058697_10498797 Open in IMG/M |
| Source Dataset Name | Agave microbial communities from Guanajuato, Mexico - As.Ma.e |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 621 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guanajuato, Mexico | |||||||
| Coordinates | Lat. (o) | 21.7658 | Long. (o) | -100.163 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019044 | Metagenome | 232 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0058697_104987972 | F019044 | AGAAG | MKLRSFFFILLLSLANAFASDLDCTLVNQTGRSFEGLYITASDNKDWDANILLDGKVLAAGGKISVRFKNDTKSETWDFNLVDDEGLSVTF* |
| ⦗Top⦘ |