NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070732_10057432

Scaffold Ga0070732_10057432


Overview

Basic Information
Taxon OID3300005542 Open in IMG/M
Scaffold IDGa0070732_10057432 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2255
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016890Metagenome / Metatranscriptome244Y
F030272Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0070732_100574322F030272N/AMLALLQRKKYGDNFVTKKAASLTIVALLLITTLFVFSQTSSQFPELDKNGKPVFPRPMPHVVYSPTDLVHSAVVLPASIGGATPNTSIIRLGDVTKMTVFASCTQNFDLVMSVYTADDQGQSSPNFILYNSYVIATNMASGAQQAFLASELAPNVTSGTLATTVRLPQLAVSFFEKNDVATAGTCTDRVIVGY*
Ga0070732_100574324F016890N/AMARETYKQAYATAKLDLLQQLQKRDDLEQKIRKLKQTVKALGELCGAAPEEIDKLLLVEGFAIDAKPGFTDAIRRLFRIHQTALSPIDIRENLLKMAIGVGQVNLLSSIHTVLRRMAEAGEIEKTEDGKFRLPG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.