Scaffold Ga0068876_10583970

Overview

Basic Information

• Taxon OID: 3300005527
• Scaffold ID: Ga0068876_10583970
• Source Dataset Name: Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 606
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location

• Location Name: USA: Ohio, Lake Erie
• Coordinates
  • Lat. (^o): 41.69957
  • Long. (^o): -83.2941

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050152	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068876_105839701	F050152	N/A	PQVSYWTHFTKYQIAQFKALAELDYQVLGERVSTEGTPDSGIAIKYPPKLKAQPFWLTWDYKTFKDFKLWTLLQATKALDLPISEKAESCLNYFSIESNQIKAMELLDPFRKENQKEFDFILQEEYNLVFPTASRISSVRFTVPSGDPFEDLEINETLQDSRLIPLTEAGEPIRKRFIKQYLQERLQEYLALGGLKELIDRR