| Basic Information | |
|---|---|
| Taxon OID | 3300005527 Open in IMG/M |
| Scaffold ID | Ga0068876_10076960 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2006 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio, Lake Erie | |||||||
| Coordinates | Lat. (o) | 41.69957 | Long. (o) | -83.2941 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039050 | Metagenome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068876_100769604 | F039050 | AGGAGG | MPDAETVSALAPLFAGPGAAVLVLLAVLFGLYIIVVKHGIPLVAALGKRHLDQIDALIGVQRAESAAITKTLASIDRRLAKLEDLSERIGVNHGALSPDRLT* |
| ⦗Top⦘ |