| Basic Information | |
|---|---|
| Taxon OID | 3300005526 Open in IMG/M |
| Scaffold ID | Ga0073909_10244460 Open in IMG/M |
| Source Dataset Name | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 795 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania, Centralia | |||||||
| Coordinates | Lat. (o) | 40.7999 | Long. (o) | -76.3402 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003958 | Metagenome / Metatranscriptome | 460 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073909_102444602 | F003958 | AGGAG | MEMNNDDFEPTMAFAVERQEPPAIEVRVNFGVFAGREATAVEIERLAEWLLDEVGEVSIISEERHEIDANVEASVHQVRIEVAADRVPPAGPERQSVIARLVERAEHWARMCVAERHAEIADGV* |
| ⦗Top⦘ |