NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068877_10125102

Scaffold Ga0068877_10125102


Overview

Basic Information
Taxon OID3300005525 Open in IMG/M
Scaffold IDGa0068877_10125102 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1592
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016494Metagenome / Metatranscriptome246N
F019949Metagenome / Metatranscriptome226N
F028417Metagenome / Metatranscriptome191N

Sequences

Protein IDFamilyRBSSequence
Ga0068877_101251022F019949N/AMYQEKNRYNKRILRFADDLLYNNLTAKDEANKETLKIEIEKYVNEPVVFRLAFNAFKIEMQEIKLLRLIEKLLHTVDKMHNLSPLQKARKFSKVYELKQKIIQINLNWKISDSFHLKKYKILTLLDKINVKEEYNSVANEEIYQQLINEVETAKGTNSTWQLDKELIIIKKIE*
Ga0068877_101251023F028417GAGMATNEFSDNKNQLITLMLQTIENFVPLETRPAPEGMAIYLYELKKEIIRQDSKFKFINPYNDYIFRILTLLDYLDVSKEYDTESHGKTVHMICRETRDIKRIDPSWKINPTSIIEFINSTSLASARK*
Ga0068877_101251024F016494N/AMSQKGNNSEEITVDNSTELGQLIRSTLQTVDELFPPKPEFSFEDMMVQIYTLKSKIKKIDPSWKFENTDISYVFEILKLLDAVNIEEIPDLQQNAKVCQRLLHRVRIMRQVNP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.