NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068877_10006258

Scaffold Ga0068877_10006258


Overview

Basic Information
Taxon OID3300005525 Open in IMG/M
Scaffold IDGa0068877_10006258 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9105
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001599Metagenome / Metatranscriptome665Y
F104514Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0068877_100062581F001599AGGVQPIGRTRLSGNMSTKGTKDSVALVWCDNGMVDGKFMQGVTDVMLKSGVEFATSLRSQGNQIARQRQTVIDYWYDKTDYEWLLWVDSDVVISPEKFKLLWDNKDAEKRPIITGIYFTTDNPEEPLMIPMPTIFNFIVGDEGGFGLTRVHPMPVNQLIKVDAAGMGFVLMHRSIVPKVREASQDGQVFMEMGRGTKFIGEDIFFFALCDKAEIPLYAHTGALAPHMKRFSFDEHYYNAFFGKPKEEPKSKLITPDKKIITPR*
Ga0068877_100062588F104514AGGMIKKNETVSIGWCDNGITDGAFTEGLMSAIFYGLSSQKLINNSIRVKGNQIARQRQVLLDTWYDNIKTDWLLWVDSDVVLTADIWNKLYDTADSKDKPMVSGIYFIAKDSDGSLPIPMPVIFDNVDKHTVKYHHPLPKDSVIKIDCAGMGLVLIHKSVVEKLRAMYGDKHFMFAEDNSVGEEFIGEDISFFRKCSAAEIPLYAHTGAIAKHMKTTAWDMDLYALYWNSKNQSSN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.