Scaffold Ga0074648_1071385

Overview

Basic Information

• Taxon OID: 3300005512
• Scaffold ID: Ga0074648_1071385
• Source Dataset Name: Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1358
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → environmental samples → uncultured marine virus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Greece: Etoliko Lagoon
• Coordinates
  • Lat. (^o): 38.4825
  • Long. (^o): 21.315
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003679	Metagenome / Metatranscriptome	474	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074648_10713851	F003679	N/A	GYQNLLIVRRLRVYRVIIKGKFKEKPINLTRAVQLMYRQPFTGSIKSEHISWWKQYWLRSINLEILQPKHGWITLVKVYREGKPSIRVITVPTSSDKRELFVMKQLHGGHNA*