Scaffold Ga0074648_1068433

Overview

Basic Information

• Taxon OID: 3300005512
• Scaffold ID: Ga0074648_1068433
• Source Dataset Name: Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1407
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Greece: Etoliko Lagoon
• Coordinates
  • Lat. (^o): 38.4825
  • Long. (^o): 21.315
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038599	Metagenome	165	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0074648_10684336	F038599	AGGA	MIDEQRLYQLDIPKENIILNDYEKQELKFFETNLIDTIERCQNNEVKKVWYKKFNWLQLNMNKYINYLRLKNYVSSKKK*