Scaffold Ga0068912_10459235

Overview

Basic Information

• Taxon OID: 3300005506
• Scaffold ID: Ga0068912_10459235
• Source Dataset Name: Soil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1014
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: USA: Colorado Plateau
• Coordinates
  • Lat. (^o): 38.42
  • Long. (^o): -109.4099

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065661	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068912_104592352	F065661	AGGAGG	MGLLAWIILLFVAAALATAAQYLFFRQDRKPTDYDWIYIAGGALIGGFTAHVWYPIGPTINGLYLLPALGGALVLGVVAELVYRFYLRPRRMA*