Scaffold Ga0068898_10499324

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068898_10499324

Scaffold Ga0068898_10499324

Overview

Basic Information
Taxon OID	3300005505 Open in IMG/M
Scaffold ID	Ga0068898_10499324 Open in IMG/M
Source Dataset Name	Soil microbial communities from Colorado Plateau and Sonoran desert - Soil Crust after wet up 5A (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	686
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location Name	Colorado Plateau and Sonoran desert
Coordinates	Lat. (^o)	38.42	Long. (^o)	-109.4099	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009946	Metagenome / Metatranscriptome	310	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068898_104993242	F009946	AGGAG	MTKMERLLEVEVGAYGTILEEIELICTMTGFRSRFLVHHIGEGFFRSVGLGPS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.