Basic Information | |
---|---|
Taxon OID | 3300005505 Open in IMG/M |
Scaffold ID | Ga0068898_10064576 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Colorado Plateau and Sonoran desert - Soil Crust after wet up 5A (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 680 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Colorado Plateau and Sonoran desert | |||||||
Coordinates | Lat. (o) | 38.42 | Long. (o) | -109.4099 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073034 | Metagenome / Metatranscriptome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068898_100645762 | F073034 | AGGAG | MADNEQRDIATRMTDSEALTQQIDEVTPEQQEWFRLAGFSRIEWQRLVYARWRHRQGLLTDNLQGQ* |
⦗Top⦘ |