Basic Information | |
---|---|
Taxon OID | 3300005504 Open in IMG/M |
Scaffold ID | Ga0074230_1695095 Open in IMG/M |
Source Dataset Name | Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1656 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor → Poplar Biomass Bioreactor Microbial Communities From Brookhaven National Lab, Ny |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upton, NY | |||||||
Coordinates | Lat. (o) | 40.869444 | Long. (o) | -72.886667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086024 | Metagenome / Metatranscriptome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074230_16950954 | F086024 | N/A | LQAVTRVKLEQASKVEMRMPTRLRNGEGRAGREETNKHLTRSAGVVSTACRYRGPDFLGHGIGKLKGFKRTG* |
⦗Top⦘ |