Scaffold Ga0074230_1152902

Overview

Basic Information

• Taxon OID: 3300005504
• Scaffold ID: Ga0074230_1152902
• Source Dataset Name: Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor → Poplar Biomass Bioreactor Microbial Communities From Brookhaven National Lab, Ny

Source Dataset Sampling Location

• Location Name: Upton, NY
• Coordinates
  • Lat. (^o): 40.869444
  • Long. (^o): -72.886667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024403	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074230_11529022	F024403	N/A	MRILLRLDVFVYAAELALNALDLMPCGFRLLGIQLRSSGARQPPLRSIHNRHHYLQIA*